PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00439.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 361aa    MW: 42162.4 Da    PI: 6.0751
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00439.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.8e-5471352129
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              ppGfrFhPtdeelv +yL+kkv+++k++l +vi++vd+yk+ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wk
  Rsa1.0_00439.1_g00010.1   7 PPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDVDLYKIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMTGFWK 91 
                              9****************************.9***************953432233667**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              atg+dk+v++ k++l+g++ktLvfykgrap+g+k++W++heyrle
  Rsa1.0_00439.1_g00010.1  92 ATGRDKSVYD-KTKLIGMRKTLVFYKGRAPNGQKSEWIIHEYRLE 135
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-593155IPR003441NAC domain
PROSITE profilePS5100558.7386155IPR003441NAC domain
PfamPF023658.0E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MESCSIPPGF RFHPTDEELV GYYLRKKVAS QKIDLDVIRD VDLYKIEPWD LQERCRIGYE  60
EQNEWYFFSH KDKKYPTGTR TNRATMTGFW KATGRDKSVY DKTKLIGMRK TLVFYKGRAP  120
NGQKSEWIIH EYRLESDENA PPQEEGWVVC RAFKKRATGQ TKNTETWSSS YFYDETVSSG  180
VNSVLDPIVY ISNQQNDIFG KGFMCKQELE GMVDDLNYMH SYHQFIQLPK LLSPSLPVMK  240
RPTSSMSISS MDNNTNYITT LDDEASFESV ISKDNKRKKN KKKQVTMTGD WRELDKLVAS  300
QLMSQDRGTS HLVSHHMNHE DMEMDSSFLL NEREENMFVN ELLNSNKDYD SEIAYLMNET  360
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-51515614169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0062011e-103AC006201.4 Arabidopsis thaliana chromosome 2 clone T27K22 map c245, complete sequence.
GenBankCP0026851e-103CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596229.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL410.0NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A078HJZ10.0A0A078HJZ1_BRANA; BnaA07g02060D protein
STRINGAl_scaffold_0003_37720.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36862661
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.10.0vascular related NAC-domain protein 1